Ehrlichia chaffeensis Arkansas: ECH_0881 Help Entry ECH_0881          CDS       T00328                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ech  Ehrlichia chaffeensis Arkansas Pathway ech01100   Metabolic pathways ech01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ech00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECH_0881 (acpP)    00074 Mycolic acid biosynthesis     ECH_0881 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECH_0881 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  ABD44500 UniProt:  Q2GFV7 LinkDB All DBs Position 903345..903620 Genome browser AA seq 91 aa AA seqDB search MESNDEKLESVKDTVTKIVIDCLKLKDEQKATLSGSTNLAKDLNLDSLDFVDLVMCLEDH FSIEISDEEAQELETIDKIEEYIRNKLSSKN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggaaagtaatgacgaaaagttagaatctgtcaaagatactgtgactaaaattgtgatt gattgtttaaaactaaaagacgaacaaaaagctactctatccggtagcactaatttagca aaagacttgaatcttgatagccttgatttcgtagatttggtaatgtgcttagaagaccat ttctccatagaaatttccgatgaagaagcacaagaacttgaaactatagataaaatagaa gagtatatacgtaataagttatcaagtaagaattga

DBGET integrated database retrieval system