Enterobacter chuandaensis: RQP59_08885 Help Entry RQP59_08885       CDS       T11050                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism echu  Enterobacter chuandaensis Pathway echu01100   Metabolic pathways echu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:echu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RQP59_08885 (acpP)    00074 Mycolic acid biosynthesis     RQP59_08885 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RQP59_08885 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 HLH Motif Other DBs NCBI-ProteinID:  WNS39650 UniProt:  A0AA96RTA3 LinkDB All DBs Position 1862067..1862303 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttgtgaactccgcttccttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system