Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C1048 Help Entry UTI89_C1048       CDS       T00338                                  Symbol yccB Name (GenBank) hypothetical protein   KO K22501   cytochrome bd-II ubiquinol oxidase subunit AppX [EC:7.1.1.7] Organism eci  Escherichia coli O18:K1:H7 UTI89 (UPEC) Pathway eci00190   Oxidative phosphorylation eci01100   Metabolic pathways eci02020   Two-component system Module eci_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:eci00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     UTI89_C1048 (yccB)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     UTI89_C1048 (yccB) Enzymes [BR:eci01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      UTI89_C1048 (yccB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Adeno_E3B Motif Other DBs NCBI-ProteinID:  ABE06532 UniProt:  Q1RDN2 LinkDB All DBs Position 1037767..1037859 Genome browser AA seq 30 aa AA seqDB search MWYLLWFVGILLMCSLSTLVLVWLDPRLKS NT seq 93 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttactttggttcgtcggcattttgttgatgtgttcgctctccacccttgtg ttggtatggctggacccgcgtctgaaaagttaa

DBGET integrated database retrieval system