Escherichia coli K-12 W3110: JW1080 Help Entry JW1080            CDS       T00068                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ecj  Escherichia coli K-12 W3110 Pathway ecj01100   Metabolic pathways ecj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ecj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JW1080 (acpP)    00074 Mycolic acid biosynthesis     JW1080 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JW1080 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  BAA35902 UniProt:  P0A6A8 Structure PDBPDBj LinkDB All DBs Position 1153192..1153428 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system