Escherichia coli 55989 (EAEC): EC55989_1206 Help Entry EC55989_1206      CDS       T00826                                  Symbol acpP Name (GenBank) acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism eck  Escherichia coli 55989 (EAEC) Pathway eck01100   Metabolic pathways eck01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eck00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EC55989_1206 (acpP)    00074 Mycolic acid biosynthesis     EC55989_1206 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EC55989_1206 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  CAU97065 UniProt:  B7LG27 LinkDB All DBs Position 1261753..1261989 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system