Escherichia coli ATCC 8739: EcolC_0716 Help Entry EcolC_0716        CDS       T00697                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism ecl  Escherichia coli ATCC 8739 Pathway ecl01100   Metabolic pathways ecl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ecl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EcolC_0716    00074 Mycolic acid biosynthesis     EcolC_0716   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EcolC_0716 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 BH4 Motif Other DBs NCBI-ProteinID:  ACA76391 LinkDB All DBs Position complement(768289..768537) Genome browser AA seq 82 aa AA seqDB search MVNREIVMDYILSCLQDLVENGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIPIN ILLDVKTPAQLMETLLPWLENK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggtaaatcgtgaaatagtaatggattacatcctttcctgtttacaggatttggtcgaa aacggtgtggaaattaagcccgacagcgatctcgtcaacgatcttggcctggagtcgatc aaagtgatggatctcttaatgatgctggaagacagattcgatatttccattcctattaat attctgctggatgtcaaaacccctgcgcaattaatggaaactctacttccatggctggag aataaataa

DBGET integrated database retrieval system