Escherichia coli ATCC 8739: EcolC_2507 Help Entry EcolC_2507        CDS       T00697                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ecl  Escherichia coli ATCC 8739 Pathway ecl01100   Metabolic pathways ecl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ecl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EcolC_2507    00074 Mycolic acid biosynthesis     EcolC_2507   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EcolC_2507 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  ACA78138 UniProt:  B1IUH1 LinkDB All DBs Position complement(2758056..2758292) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system