Escherichia coli ATCC 8739: EcolC_2921 Help Entry EcolC_2921        CDS       T00697                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism ecl  Escherichia coli ATCC 8739 Pathway ecl00190   Oxidative phosphorylation ecl01100   Metabolic pathways ecl02020   Two-component system Module ecl_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:ecl00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     EcolC_2921  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     EcolC_2921 Enzymes [BR:ecl01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      EcolC_2921 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ACA78548 LinkDB All DBs Position complement(3181011..3181124) Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattctgggaacgcttcttgcctgttcgtttggggtaatcacc gcgctggcgcttgaacacgtcgaatcaggcaaagccggtcaagaagacatctga

DBGET integrated database retrieval system