Escherichia coli ATCC 8739: EcolC_3373 Help Entry EcolC_3373        CDS       T00697                                  Name (GenBank) anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism ecl  Escherichia coli ATCC 8739 Pathway ecl02020   Two-component system ecl02026   Biofilm formation - Escherichia coli ecl02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:ecl00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     EcolC_3373  09140 Cellular Processes   09145 Cellular community - prokaryotes    02026 Biofilm formation - Escherichia coli     EcolC_3373   09142 Cell motility    02040 Flagellar assembly     EcolC_3373  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:ecl02035]     EcolC_3373 Bacterial motility proteins [BR:ecl02035]  Flagellar system   Flagellar assembly proteins    Others     EcolC_3373 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM SP_0191-like HH_YBHG Motif Other DBs NCBI-ProteinID:  ACA78992 LinkDB All DBs Position 3693010..3693288 Genome browser AA seq 92 aa AA seqDB search MKITPTMPGNRPTATTAGSSQPRKTTATTTTTLSADDITQAGLQSAQQTLNDQQESDIDS DKVAQMQAMLASGSLQVDTEQLASDMLSFFQN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaaaatcaccccgactatgccaggcaatcgcccgacagccacaacggcaggctccagc cagccgcgcaaaaccacggcgaccaccaccacgacgctgagcgccgacgacattactcag gcgggattgcagtccgcccagcaaacgctgaacgaccagcaagagagcgatatcgacagc gacaaagtggcgcaaatgcaggcgatgctggcctccggcagcctgcaagtggacaccgaa cagttagccagcgacatgctgagttttttccagaactaa

DBGET integrated database retrieval system