Enterobacter cloacae ECNIH2: ECNIH2_22050 Help Entry ECNIH2_22050      CDS       T03471                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ecle  Enterobacter cloacae ECNIH2 Pathway ecle01100   Metabolic pathways ecle01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ecle00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECNIH2_22050    00074 Mycolic acid biosynthesis     ECNIH2_22050   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECNIH2_22050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIE65984 UniProt:  A0A9W3Q4S8 LinkDB All DBs Position 4548413..4548670 Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIISTLNLEELTPEDIDTDAALFGDGLGLDSIDALELGLAVKNQYGVVLS AESDEMRQHFYSVATLAAFIHQQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctctatcttgaaattaagaatctcattatctctacgctgaatctggaagaa cttaccccagaggatattgatacagacgccgcgctctttggcgacggcctcggtctggac tcaatcgacgcccttgagctggggctggcggtaaaaaatcagtacggcgtagtgctttct gccgaaagtgacgagatgcgtcagcacttctattccgttgccacgctcgcggcttttatc catcaacaacgcgcctga

DBGET integrated database retrieval system