Enterocloster clostridioformis: QMP25_07920 Help Entry QMP25_07920       CDS       T10536                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eclf  Enterocloster clostridioformis Pathway eclf01100   Metabolic pathways eclf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eclf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QMP25_07920    00074 Mycolic acid biosynthesis     QMP25_07920   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QMP25_07920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding AAA_21 Motif Other DBs NCBI-ProteinID:  XBX15834 LinkDB All DBs Position 1472531..1472779 Genome browser AA seq 82 aa AA seqDB search MSTITGLSELILKMIADILELSVDNVSEEQNFIEIGMISIGFINLIIKCETEFDIEFEDD KFLMSNFSTISDFISYVQSLTL NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgagtacaattactggtttatcagaattgatattaaaaatgattgccgacatattggag ctatcggtagataatgtatctgaagagcagaactttattgaaatcggtatgatttcaatc ggatttattaacttaataatcaaatgtgagacagaatttgatatagagtttgaggatgat aaattcttaatgtctaatttttctacaatttctgattttataagctatgttcaatctcta acgctatga

DBGET integrated database retrieval system