Enterobacter cloacae GGT036: EC036_16520 Help Entry EC036_16520       CDS       T03429                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eclg  Enterobacter cloacae GGT036 Pathway eclg01100   Metabolic pathways eclg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eclg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EC036_16520    00074 Mycolic acid biosynthesis     EC036_16520   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EC036_16520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 HLH Motif Other DBs NCBI-ProteinID:  AIV29299 UniProt:  A0A0P8LEP8 LinkDB All DBs Position 1793818..1794054 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttgtgaactccgcttccttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaagatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system