Enterobacter cloacae ECNIH5: ECNIH5_08240 Help Entry ECNIH5_08240      CDS       T03706                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ecli  Enterobacter cloacae ECNIH5 Pathway ecli01100   Metabolic pathways ecli01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ecli00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECNIH5_08240    00074 Mycolic acid biosynthesis     ECNIH5_08240   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECNIH5_08240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH Motif Other DBs NCBI-ProteinID:  AIX58751 UniProt:  A0A0P8LEP8 LinkDB All DBs Position 1742576..1742812 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttgtgaactccgcttcctttgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system