Enterobacter cloacae ECNIH5: ECNIH5_20690 Help Entry ECNIH5_20690      CDS       T03706                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ecli  Enterobacter cloacae ECNIH5 Pathway ecli01100   Metabolic pathways ecli01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ecli00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECNIH5_20690    00074 Mycolic acid biosynthesis     ECNIH5_20690   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECNIH5_20690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIX61043 UniProt:  A0A2U9M3L7 LinkDB All DBs Position 4355203..4355460 Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIISTLNLEELTPEDIDTDAALFGDGLGLDSIDALELGLAVKNQYGVVLS AESDEMRQHFYSVATLAAFIHQQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctctatcttgaaattaagaatctcattatctctacgctgaatctggaagaa cttaccccagaggatattgatacagacgccgcgctctttggcgacggcctcggtctggac tcaatcgacgcccttgagctggggctggcggtaaaaaatcagtacggcgtagtgctttct gccgaaagtgacgagatgcgtcagcacttctattccgttgccacgctcgcggcttttatt catcaacaacgcgcctga

DBGET integrated database retrieval system