Enterobacter hormaechei NCTC 9394: ENC_26730 Help Entry ENC_26730         CDS       T02615                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism eclo  Enterobacter hormaechei NCTC 9394 Pathway eclo01100   Metabolic pathways eclo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eclo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ENC_26730    00074 Mycolic acid biosynthesis     ENC_26730   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ENC_26730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CBK86166 LinkDB All DBs Position 2702570..2702827 Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIISTLNLEELTPEDIDTDAALFGDGLGLDSIDALELGLAVKNQYGVVLS AESDEMRQHFYSVATLAAFIHQQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctctatctcgaaattaagaatctcattatctctacgctgaatctggaagaa cttaccccagaggatattgatacagacgccgcgctctttggcgacggcctcggtctggac tcaatcgacgcccttgagctggggctggcggtaaaaaatcagtacggcgtagtgctttct gccgaaagtgacgagatgcgtcagcacttctattccgttgccacgctcgcggcttttatc catcaacaacgcgcctga

DBGET integrated database retrieval system