Enterobacter roggenkampii 35734: LI67_009640 Help Entry LI67_009640       CDS       T04878                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ecls  Enterobacter roggenkampii 35734 Pathway ecls01100   Metabolic pathways ecls01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ecls00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LI67_009640    00074 Mycolic acid biosynthesis     LI67_009640   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LI67_009640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 HLH Motif Other DBs NCBI-ProteinID:  AKZ72990 UniProt:  A0A167P0F2 LinkDB All DBs Position 1:1856943..1857179 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttgtgaactccgcttccttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system