Escherichia coli K-12 MG1655: b1061 Help Entry b1061             CDS       T00007                                  Symbol dinI Name (RefSeq) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism eco  Escherichia coli K-12 MG1655 Brite KEGG Orthology (KO) [BR:eco00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:eco03400]     b1061 (dinI) DNA repair and recombination proteins [BR:eco03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     b1061 (dinI) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Motif Other DBs NCBI-GeneID:  945022 NCBI-ProteinID:  NP_415579 Pasteur:  dinI RegulonDB:  RDBECOLIGNC03423 ECOCYC:  G6558 ASAP:  ABE-0003599 UniProt:  P0ABR1 Structure PDBPDBj LinkDB All DBs Position complement(1121242..1121487) Genome browser AA seq 81 aa AA seqDB search MRIEVTIAKTSPLPAGAIDALAGELSRRIQYAFPDNEGHVSVRYAAANNLSVIGATKEDK QRISEILQETWESADDWFVSE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgaattgaagtcaccatagcgaaaacttctccattgccagctggggctattgacgcc ctggctggcgaactttcccgccgtattcagtatgcgtttcctgataatgaaggccacgta tcggtacgttatgccgcagcgaataatttatcggttattggcgcgacaaaagaagataaa cagcgcattagtgaaattctccaggaaacgtgggaaagcgccgatgactggtttgtcagc gaataa

DBGET integrated database retrieval system