Escherichia coli APEC O78 (APEC): APECO78_09430 Help Entry APECO78_09430     CDS       T02445                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism ecoa  Escherichia coli APEC O78 (APEC) Pathway ecoa01100   Metabolic pathways ecoa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ecoa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     APECO78_09430    00074 Mycolic acid biosynthesis     APECO78_09430   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     APECO78_09430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AGC86617 LinkDB All DBs Position 1937676..1937912 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system