Escherichia coli APEC O78 (APEC): APECO78_18675 Help Entry APECO78_18675     CDS       T02445                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism ecoa  Escherichia coli APEC O78 (APEC) Pathway ecoa01100   Metabolic pathways ecoa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ecoa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     APECO78_18675    00074 Mycolic acid biosynthesis     APECO78_18675   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     APECO78_18675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 BH4 Motif Other DBs NCBI-ProteinID:  AGC88452 LinkDB All DBs Position 3879663..3879911 Genome browser AA seq 82 aa AA seqDB search MVNREIVMDYILSCLQDLVENGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIPIN ILLDVKTPAQLMETLLPWLENK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggtaaatcgtgaaatagtaatggattacatcctttcctgtttacaggatttggtcgaa aacggtgtggaaattaagcccgacagcgatctcgtcaacgatcttggcctggagtcgatc aaagtgatggatctcttaatgatgctggaagacagattcgatatttccattcctattaat attctgctggatgtcaaaacccctgcgcaattaatggaaactctacttccatggctggag aataaataa

DBGET integrated database retrieval system