Escherichia coli B C3029: C3029_09325 Help Entry C3029_09325       CDS       T09610                                  Name (GenBank) hypothetical protein   KO K22501   cytochrome bd-II ubiquinol oxidase subunit AppX [EC:7.1.1.7] Organism ecob  Escherichia coli B C3029 Pathway ecob00190   Oxidative phosphorylation ecob01100   Metabolic pathways ecob02020   Two-component system Module ecob_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:ecob00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     C3029_09325  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     C3029_09325 Enzymes [BR:ecob01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      C3029_09325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Adeno_E3B Motif Other DBs NCBI-ProteinID:  AMH26204 LinkDB All DBs Position 1858490..1858582 Genome browser AA seq 30 aa AA seqDB search MWYLLWFVGILLMCSLSTLVLVWLDPRLKS NT seq 93 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttactttggttcgtcggcattttgttgatgtgttcgctctccacccttgtg ttggtatggctggacccgcgtctgaaaagttaa

DBGET integrated database retrieval system