Escherichia coli B C3029: C3029_22185 Help Entry C3029_22185       CDS       T09610                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism ecob  Escherichia coli B C3029 Brite KEGG Orthology (KO) [BR:ecob00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ecob03110]     C3029_22185 Chaperones and folding catalysts [BR:ecob03110]  Protein folding catalysts   Protein disulfide isomerase    C3029_22185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR GST_N Thioredoxin_2 Thioredoxin_3 CLIC-like_N Motif Other DBs NCBI-ProteinID:  AMH28562 LinkDB All DBs Position complement(4450052..4450303) Genome browser AA seq 83 aa AA seqDB search MANVEIYTKETCPYCHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGRTTVPQIFIDA QHIGGCDDLYALDARGGLDPLLK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggccaatgttgaaatctataccaaagaaacctgcccgtattgccatcgtgcaaaagca ctgctgagcagcaagggcgtgagttttcaggagttgccgatcgatggcaatgccgccaag cgtgaagagatgatcaaacgcagcggtcgcaccacggttccccagatttttattgacgca cagcacattggcggctgtgatgacttgtatgcattggatgcacgtggtggactggatccc ctgctgaaataa

DBGET integrated database retrieval system