Eupeodes corollae: 129941975 Help Entry 129941975         CDS       T09463                                  Name (RefSeq) dynein light chain Tctex-type   KO K10420   dynein light chain Tctex-type 1/3 Organism ecoe  Eupeodes corollae Pathway ecoe04814   Motor proteins Brite KEGG Orthology (KO) [BR:ecoe00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     129941975  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ecoe03037]     129941975    04812 Cytoskeleton proteins [BR:ecoe04812]     129941975 Cilium and associated proteins [BR:ecoe03037]  Motile cilia and associated proteins   Dynein arm    129941975 Cytoskeleton proteins [BR:ecoe04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      129941975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 DOP1_C DUF6547 Motif Other DBs NCBI-GeneID:  129941975 NCBI-ProteinID:  XP_055906737 LinkDB All DBs Position 1:99360497..99361396 Genome browser AA seq 111 aa AA seqDB search MEDVREENQFVVDDVSKIIKEAIEQTIGGNAYQHDKVNNWTSLVVENCLSVLTKEQKPYK YIVTSMIMQKNGAGLHTASSCFWNNDTDGSCTVRWENKTMYCIVSVFGLAV NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggaagacgttcgcgaggaaaaccaattcgttgtggatgatgtaagcaaaatcatcaag gaagccatcgagcaaacaatcggcggtaacgcctaccagcacgacaaagtcaacaactgg accagcctggtcgtcgagaactgtctcagtgtcctcaccaaggaacagaagccctacaag tacatcgtcacatccatgattatgcagaaaaacggcgccggactccatacagcaagctcg tgcttctggaacaacgacaccgatggctcgtgcaccgttcgttgggagaacaagaccatg tattgcattgtttccgtttttggtttggccgtttaa

DBGET integrated database retrieval system