Eupeodes corollae: 129944100 Help Entry 129944100         CDS       T09463                                  Name (RefSeq) LIRP-like   KO K04526   insulin Organism ecoe  Eupeodes corollae Pathway ecoe04068   FoxO signaling pathway ecoe04081   Hormone signaling ecoe04140   Autophagy - animal ecoe04150   mTOR signaling pathway ecoe04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:ecoe00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     129944100    04150 mTOR signaling pathway     129944100   09133 Signaling molecules and interaction    04081 Hormone signaling     129944100  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129944100  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     129944100  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ecoe04052]     129944100 Cytokines and neuropeptides [BR:ecoe04052]  Neuropeptides   Unclassified    129944100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  129944100 NCBI-ProteinID:  XP_055909263 LinkDB All DBs Position 2:120552912..120553586 Genome browser AA seq 123 aa AA seqDB search MASSNTYSGIRAMLVIIVCLVVVNLSLGEQRFCGNKLRNVIELMCPNGVNGYKEKRSLLP MDEELSTETTEEDFNFGLSLDMLPLMDNSDSGIAKIRRRRHGIAHECCDKPCSIKEIVSY CRN NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggcatcttcaaacacatattctggaatacgagcaatgctcgtgataattgtgtgcctt gtagttgtaaatctttcactcggagaacaaagattttgtggtaataaactacgaaatgtc atcgaactgatgtgtccaaatggtgtcaatgggtataaggaaaaaagaagcttacttcca atggatgaggaactaagcactgaaaccactgaagaagatttcaattttggcttgagtctg gatatgttaccattgatggataacagtgacagtgggattgccaaaattcgacgtaggaga cacggaattgcacatgaatgctgtgacaagccttgcagtataaaagaaattgtttcctat tgtcgaaattaa

DBGET integrated database retrieval system