Eupeodes corollae: 129944343 Help Entry 129944343         CDS       T09463                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ecoe  Eupeodes corollae Pathway ecoe04013   MAPK signaling pathway - fly ecoe04145   Phagosome ecoe04148   Efferocytosis ecoe04310   Wnt signaling pathway ecoe04620   Toll-like receptor signaling pathway ecoe05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ecoe00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     129944343    04310 Wnt signaling pathway     129944343  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     129944343    04148 Efferocytosis     129944343  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129944343  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     129944343  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ecoe04131]     129944343   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ecoe04147]     129944343    04031 GTP-binding proteins [BR:ecoe04031]     129944343 Membrane trafficking [BR:ecoe04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     129944343  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     129944343   Macropinocytosis    Ras GTPases     129944343  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     129944343 Exosome [BR:ecoe04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129944343   Exosomal proteins of other body fluids (saliva and urine)    129944343   Exosomal proteins of colorectal cancer cells    129944343   Exosomal proteins of bladder cancer cells    129944343 GTP-binding proteins [BR:ecoe04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     129944343 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  129944343 NCBI-ProteinID:  XP_055909681 LinkDB All DBs Position 2:complement(120908993..120910307) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSVPIILVGTKLDLR EDKLTIEKLKDKKLSPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPV MRPKSKRKCALL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagctataaagtgtgtggttgtgggcgatggagccgtgggtaagacctgtctgctg attagctacacaacaaatgccttcccaggagaatacatcccgacggtgttcgacaactac tctgcaaatgttatggtcgatgccaagcccataaacctgggcctctgggatacagctgga caagaggactacgatcgtttgagaccattgtcctatccacaaaccgatgtcttcctaatt tgcttttcgctggtcaatccagcctcgtttgagaacgttcgggcgaagtggtatcccgag gtacgtcatcattgcccgagtgtgccaatcatcttggtcggaaccaagttggatctgcgc gaggacaaactaaccatcgaaaaactaaaagataagaagctatcaccaataacctatccc caaggattggccatggccaaggaaattggtgctgtcaagtatttggaatgttcagcattg acgcagaaaggactaaagactgtcttcgatgaggctatcaggtcggtgttgtgtccggtg atgcgccccaaatccaaacgcaagtgcgcactgctctaa

DBGET integrated database retrieval system