Eupeodes corollae: 129944717 Help Entry 129944717         CDS       T09463                                  Name (RefSeq) probable insulin-like peptide 3   KO K04526   insulin Organism ecoe  Eupeodes corollae Pathway ecoe04068   FoxO signaling pathway ecoe04081   Hormone signaling ecoe04140   Autophagy - animal ecoe04150   mTOR signaling pathway ecoe04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:ecoe00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     129944717    04150 mTOR signaling pathway     129944717   09133 Signaling molecules and interaction    04081 Hormone signaling     129944717  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129944717  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     129944717  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ecoe04052]     129944717 Cytokines and neuropeptides [BR:ecoe04052]  Neuropeptides   Unclassified    129944717 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta P3A Motif Other DBs NCBI-GeneID:  129944717 NCBI-ProteinID:  XP_055910327 LinkDB All DBs Position 2:complement(122914727..122915415) Genome browser AA seq 123 aa AA seqDB search MGSSKIFSGIKGLLMVVVCLSIVNLSLGQQKFCGHDLRAVIELMCPKGVNGYETKRSFSI DEDLSNENTEEDFSFGQSFDMLPFLRMMETNGIAQTRRRRDGIAHECCLKACHTSEIIKY CRK NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgggatcttcgaaaatcttctctggaatcaagggcctactgatggttgttgtatgtctg tcgatagttaatctttcacttggtcaacaaaagttttgtggtcatgacttacgtgctgtt atagaattgatgtgtccaaaaggtgtcaatggatatgaaacgaaacgaagtttttcaatc gacgaagatctaagcaatgaaaatactgaagaagactttagttttggacaaagctttgat atgttgccatttttgaggatgatggaaaccaatggaattgcccagactcgtcgcagaagg gatggtattgcacatgagtgttgtttgaaggcttgtcatacatcagaaattataaagtat tgtcgaaagtaa

DBGET integrated database retrieval system