Eupeodes corollae: 129952898 Help Entry 129952898         CDS       T09463                                  Name (RefSeq) dynein axonemal light chain 4   KO K10412   dynein axonemal light chain 4 Organism ecoe  Eupeodes corollae Pathway ecoe04814   Motor proteins Brite KEGG Orthology (KO) [BR:ecoe00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     129952898  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ecoe03037]     129952898    04812 Cytoskeleton proteins [BR:ecoe04812]     129952898 Cilium and associated proteins [BR:ecoe03037]  Motile cilia and associated proteins   Dynein arm    129952898 Cytoskeleton proteins [BR:ecoe04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      129952898 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light YcxB Ground-like Motif Other DBs NCBI-GeneID:  129952898 NCBI-ProteinID:  XP_055921814 LinkDB All DBs Position 3:complement(53120520..53121614) Genome browser AA seq 106 aa AA seqDB search MAEEGGKPEESGEKKIVHVYPLVKHTDMVEEMRNETIELTITACEKYASNYETAAKVIKE TMDKKFGTYWHVVVGEGFGFEVSFETKNILYLFFGGNLAIVVWKCS NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggctgaagagggtggtaaaccggaagaatcaggcgaaaagaaaattgttcatgtgtat ccgctagtaaagcacacggacatggtagaggaaatgagaaacgagactatcgagttgacc ataactgcctgtgagaaatatgcttccaactatgagacagcggcaaaagttatcaaagag acgatggacaaaaagtttggaacgtattggcatgtggtggtcggtgaaggattcggcttc gaagtgtcctttgagacgaaaaatattttatatttatttttcggaggcaatttggcaatc gttgtgtggaagtgttcatga

DBGET integrated database retrieval system