Paremcibacter congregatus: FIV45_06885 Help Entry FIV45_06885       CDS       T06024                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ecog  Paremcibacter congregatus Pathway ecog00998   Biosynthesis of various antibiotics ecog01100   Metabolic pathways ecog01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ecog00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FIV45_06885    00074 Mycolic acid biosynthesis     FIV45_06885   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FIV45_06885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QDE27019 LinkDB All DBs Position complement(1553187..1553438) Genome browser AA seq 83 aa AA seqDB search MSTIEEVREILRATLQIADRADDLERDTPLLGNIPELDSMAVAMLVTSMEEHFDIFVDDD DISAETFETFGSLCDFAVEKVAE NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtcgacaattgaagaagttcgggaaatattaagagccacattacagattgctgatcgg gctgatgaccttgagcgcgacacccctcttctcggcaatattccagaactggattccatg gcggtcgccatgctggtgacatctatggaggagcatttcgatatttttgtagacgatgat gacatcagcgccgaaacttttgaaacctttggcagcctgtgcgatttcgcggtcgaaaaa gtcgccgaataa

DBGET integrated database retrieval system