KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_0802
Entry
ECRM13516_0802    CDS       T03011                                 
Symbol
espJ
Name
(GenBank) T3SS effector protein EspJ
  KO
K23648  T3SS secreted effector ADP-ribosyltransferase EspJ
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_0802 (espJ)
SSDB
Motif
Pfam: AvrPphF-ORF-2 DUF3319
Other DBs
NCBI-ProteinID: AHG13476
LinkDB
Position
complement(830709..831362)
AA seq 217 aa
MPIIKNCLSSISNILRNEKTSYSLIKTEQTGKLLNRKITTTPTPAKLLSYRNADLIKENY
ITEKVLSIFNIKRDFVAVRIQSNQFTDLKNKTIQGHKDTVAKVIDWYNPQKNAFGIMMGT
PRCSADIAKEESRNALNFMIMEKDTFNEKILNSNANLQKKYGTTENSSWVSASVGSLLDK
GAKVYPDISCSLRLGEPFIITLPETVRLDVNIHPLKK
NT seq 654 nt   +upstreamnt  +downstreamnt
atgccaatcataaagaactgcttatcatcaattagtaacatattacgcaacgaaaaaaca
tcatattctctaataaaaacagagcaaacaggaaaactgttaaacagaaaaataaccacc
actcccacaccagcgaaactattatcatatcgaaatgcagatttaataaaagaaaactac
attacagaaaaagttttatctattttcaatataaaacgggatttcgttgctgtaagaatc
caaagtaatcagtttactgatttaaaaaacaagacaattcagggtcataaagacactgtc
gcaaaagtcatagactggtataacccacaaaaaaacgcatttggtatcatgatgggcaca
ccaagatgttctgctgatatagcaaaggaagaatccagaaacgctctaaatttcatgata
atggaaaaggatacatttaatgaaaagatacttaacagcaatgctaatttacaaaaaaaa
tacggcacaacagaaaatagtagttgggtatcggcttctgttggttctcttctggacaaa
ggagccaaagtatatccagatatatcatgctctctgagactgggagaaccattcattatt
acacttccagaaacagtcaggctggatgttaatatccacccactcaaaaaatga

DBGET integrated database retrieval system