KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_1074
Entry
ECRM13516_1074    CDS       T03011                                 
Symbol
tccP
Name
(GenBank) T3SS secreted effector TccP
  KO
K12789  Tir-cytoskeleton coupling protein
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh02024  Quorum sensing
ecoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ECRM13516_1074 (tccP)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_1074 (tccP)
SSDB
Motif
Pfam: EspF LELP1
Other DBs
NCBI-ProteinID: AHG13745
LinkDB
Position
complement(1110521..1111273)
AA seq 250 aa
MINSINSFFSSIPRSISSVTRNSSFTASQHKSTPNTVKTSSPLSPSNSPASATTIFKVKN
SYTESGLQRSTSYTQSSIEKNALHRPLPDVAKRLVQHLAEHGIQPARNMAEHIPPAPNWP
APTPPVQNEQSRPLPDVAQRLVQHLAEHGIQPARNMAEHIPPAPNWPAPTPPIQNEQSRP
LPDVAQRLVQHLAEHGIQPARNMAEHIPPAPNWPAPTPPVQNEQSRPLPDVAQRLMQHLA
EHGINTSKRS
NT seq 753 nt   +upstreamnt  +downstreamnt
atgataaatagcattaattcttttttttccagcattcctcgcagtatatcaagtgttacg
cgtaacagtagcttcactgcctcacagcacaaaagcacacctaacacggtaaaaaccagc
tcacctctttctcccagcaacagtcctgccagtgcaacaactatttttaaggtaaaaaat
tcttatacggaatcaggacttcaacgttccacatcttatactcagtcaagtatagaaaaa
aacgctttacatcggcctctacctgatgtggccaaacgcctagtgcagcatcttgcagag
catggcattcaaccagcccggaatatggctgaacatattcctccggcacctaactggcct
gcgccaacgccgccagtacaaaatgaacaatcaagacctctgcctgatgtggctcagcgt
ctggtgcagcatcttgcagagcatggcattcaaccagcccggaatatggctgaacatatt
cctccggcacctaactggcctgcgccaacgccgccgatacaaaatgaacaatcaagacct
ctgcctgatgtggctcagcgtctggtgcagcatcttgcagagcatggcattcaaccagcc
cggaatatggctgaacatattcctccggcacctaactggcctgcgccaacgccgccggta
caaaatgaacaatcaagacctctgcctgatgtggctcagcgtctgatgcagcatcttgca
gagcatggcattaatacatctaagcgctcgtga

DBGET integrated database retrieval system