KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_2457
Entry
ECRM13516_2457    CDS       T03011                                 
Symbol
nleF
Name
(GenBank) T3SS secreted effector protein NleF
  KO
K23658  T3SS secreted effector NleF
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_2457 (nleF)
SSDB
Motif
Pfam: NleF_casp_inhib DUF4468
Other DBs
NCBI-ProteinID: AHG15119
LinkDB
Position
complement(2417844..2418413)
AA seq 189 aa
MLPTSGSSANLYSWMYVSGRGNPSTPESVSELNHNHFLTPELQDKLDVMISIYSNARNSN
ELEEIYQELSAFVSGLMDKRNSVFEVRNENTDEVVGALREGMTIDDRDGYIRELFFLYSL
KVKIEESRQGKEDSKCKVYGLLCPHHSSELYGDLRAMKCLVEGCSDDFDPFDIIRVPDLT
YNKGALQCG
NT seq 570 nt   +upstreamnt  +downstreamnt
atgttaccaacaagtggctcttcagcaaatctttattcatggatgtatgtatcaggaaga
ggtaacccttcgactccggaatcagtaagtgaacttaatcataatcattttcttactcct
gaattacaagataaacttgatgttatgatctctatatactcaaatgccagaaatagtaat
gagcttgaggaaatttatcaagagctaagtgcttttgtaagtgggctgatggataagaga
aatagtgtatttgaggtgagaaatgaaaatactgatgaggttgtcggagcactgagggag
gggatgacgatagatgacagggatggttatatcagggagcttttttttctgtattcattg
aaagtaaaaattgaggaaagtagacaaggtaaagaagattctaaatgtaaagtttatggt
ctgttatgtccgcatcactcttcagagctatatggtgatctacgagcaatgaaatgtctt
gtggaaggatgcagtgatgattttgatccttttgatattattagggtgccggatcttact
tacaacaaaggagctttacaatgtggatga

DBGET integrated database retrieval system