KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_4476
Entry
ECRM13516_4476    CDS       T03011                                 
Symbol
eae
Name
(GenBank) intimin adherence protein
  KO
K12790  intimin
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_4476 (eae)
SSDB
Motif
Pfam: IAT_beta Intimin_C Big_1 LysM Big_2 DUF4198 Glyco_hydro2_C5 MG4 DUF6795 PilX YtkA
Other DBs
NCBI-ProteinID: AHG17091
LinkDB
Position
complement(4430514..4433318)
AA seq 934 aa
MITHGCYTRTRHKHKLKKTLIMLSAGLGLFFYVNQNSFANGENYFKLGSDSKLLTHDSYQ
NRLFYTLKTGETVADLSKSQDINLSTIWSLNKHLYSSESEMMKAAPGQQIILPLKKLPFE
YSALPLLGSAPLVAAGGVAGHTNKLTKMSPDVTKSNMTDDKALNYAAQQAASLGSQLQSR
SLNGDYAKDTALGIAGNQASSQLQAWLQHYGTAEVNLQSGNNFDGSSLDFLLPFYDSEKM
LAFGQVGARYIDSRFTANLGAGQRFFLPANMLGYNVFIDQDFSGDNTRLGIGGEYWRDYF
KSSVNGYFRMSGWHESYNKKDYDERPANGFDIRFNGYLPSYPALGAKLIYEQYYGDNVAL
FNSDKLQSNPGAATVGVNYTPIPLVTMGIDYRHGTGNENDLLYSMQFRYQFDKSWSQQIE
PQYVNELRTLSGSRYDLVQRNNNIILEYKKQDILSLNIPHDINGTEHSTQKIQLIVKSKY
GLDRIVWDDSALRSQGGQIQHSGSQSAQDYQAILPAYVQGGSNIYKVTARAYDRNGNSSN
NVQLTITVLSNGQVVDQVGVTDFTADKTSAKADNADTITYTATVKKNGVAQANVPVSFNI
VSGTATLGANSAKTDANGKATVTLKSSTPGQVVVSAKTAEMTSALNASAVIFFDQTKASI
TEIKADKTTAVANGKDAIKYTVKVMKNGQPVNNQSVTFSTNFGMFNGKSQTQATTGNDGR
ATITLTSSSTGKATVSATVSDGAEVKATEVTFFDELKIDNKVDIIGNNVRGELPNIWLQY
GQFKLKASGGDGTYSWYSENTSIATVDASGKVTLNGKGSVVIKATSGDKQTVSYTIKAPS
YMIKVDKQAYYADAMSICKNLLPSTQTVLSDIYDSWGAANKYSHYSSMNSITAWIKQTSS
EQSSGVSSTYNLITQNPLPGVNVNTPNVYAVCVE
NT seq 2805 nt   +upstreamnt  +downstreamnt
atgattactcatggttgttatacccggacccggcacaagcataagctaaaaaaaacattg
attatgcttagtgctggtttaggattgtttttttatgttaatcagaattcatttgcaaat
ggtgaaaattattttaaattgggttcggattcaaaactgttaactcatgatagctatcag
aatcgccttttttatacgttgaaaactggtgaaactgttgccgatctttctaaatcgcaa
gatattaatttatcgacgatttggtcgttgaataagcatttatacagttctgaaagcgaa
atgatgaaggccgcgcctggtcagcagatcattttgccactcaaaaaacttccctttgaa
tacagtgcactaccacttttaggttcggcacctcttgttgctgcaggtggtgttgctggt
cacacgaataaactgactaaaatgtccccggacgtgaccaaaagcaacatgaccgatgac
aaggcattaaattatgcggcacaacaggcggcgagtctcggtagccagcttcagtcgcga
tctctgaacggtgattacgcgaaagataccgctcttggtatcgctggtaaccaggcttcg
tcacagttgcaggcctggttacaacattatgggacggcagaggttaatctgcagagtggt
aataactttgacggtagttcactggacttcttattaccgttctatgattccgaaaaaatg
ctggcatttggtcaggtcggagcgcgttacattgactcccgctttacggcaaatttaggt
gcgggtcagcgttttttccttcctgcaaacatgttgggctataacgtcttcattgatcag
gatttttctggtgataatacccgtttaggtattggtggcgaatactggcgagactatttc
aaaagtagcgttaacggctatttccgcatgagcggctggcatgagtcatacaataagaaa
gactatgatgagcgcccagcaaatggcttcgatatccgttttaatggctatctaccgtca
tatccggcattaggcgccaagctgatatatgagcagtattatggtgataatgttgctttg
tttaattctgataagctgcagtcgaatcctggtgcggcgaccgttggtgtaaactatact
ccgattcctctggtgacgatggggatcgattaccgtcatggtacgggtaatgaaaatgat
ctcctttactcaatgcagttccgttatcagtttgataaatcgtggtctcagcaaattgaa
ccacagtatgttaacgagttaagaacattatcaggcagccgttacgatctggttcagcgt
aataacaatattattctggagtacaagaagcaggatattctttctctgaatattccgcat
gatattaatggtactgaacacagtacgcagaagattcagttgatcgttaagagcaaatac
ggtctggatcgtatcgtctgggatgatagtgcattacgcagtcagggcggtcagattcag
catagcggaagccaaagcgcacaagactaccaggctattttgcctgcttatgtgcaaggt
ggcagcaatatttataaagtgacggctcgcgcctatgaccgtaatggcaatagctctaac
aatgtacagcttactattaccgttctgtcgaatggtcaagttgtcgaccaggttggggta
acggactttacggcggataagacttcggctaaagcggataacgccgataccattacttat
accgcgacggtgaaaaagaatggggtagctcaggctaatgtccctgtttcatttaatatt
gtttcaggaactgcaactcttggggcaaatagtgccaaaacggatgctaacggtaaggca
accgtaacgttgaagtcgagtacgccaggacaggtcgtcgtgtctgctaaaaccgcggag
atgacttcagcacttaatgccagtgcggttatattttttgatcaaaccaaggccagcatt
actgagattaaggctgataagacaactgcagtagcaaatggtaaggatgctattaaatat
actgtaaaagttatgaaaaacggtcagccagttaataatcaatccgttacattctcaaca
aactttgggatgttcaacggtaagtctcaaacgcaagcaaccacgggaaatgatggtcgt
gcgacgataacactaacttccagttccaccggtaaagcgactgttagtgcgacagtcagt
gatggggctgaggttaaagcgactgaggtcactttttttgatgaactgaaaattgacaac
aaggttgatattattggtaacaatgtcagaggcgagttgcctaatatttggctgcaatat
ggtcagtttaaactgaaagcaagcggtggtgatggtacatattcatggtattcagaaaat
accagtatcgcgactgtcgatgcatcagggaaagtcactttgaatggtaaaggcagtgtc
gtaattaaagccacatctggtgataagcaaacagtaagttacactataaaagcaccgtcg
tatatgataaaagtggataagcaagcctattatgctgatgctatgtccatttgcaaaaat
ttattaccatccacacagacggtattgtcagatatttatgactcatggggggctgcaaat
aaatatagccattatagttctatgaactcaataactgcttggattaaacagacatctagt
gagcagagttctggagtatcaagcacttataacctaataacacaaaaccctcttcctggg
gttaatgttaatactccaaatgtctatgcggtttgtgtagaataa

DBGET integrated database retrieval system