Escherichia coli O18 K1 PMV-1 (ExPEC): ECOPMV1_01010 Help Entry ECOPMV1_01010     CDS       T02847                                  Symbol yccB Name (GenBank) hypothetical protein   KO K22501   cytochrome bd-II ubiquinol oxidase subunit AppX [EC:7.1.1.7] Organism ecoi  Escherichia coli O18:K1 PMV-1 (ExPEC) Pathway ecoi00190   Oxidative phosphorylation ecoi01100   Metabolic pathways ecoi02020   Two-component system Module ecoi_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:ecoi00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     ECOPMV1_01010 (yccB)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     ECOPMV1_01010 (yccB) Enzymes [BR:ecoi01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      ECOPMV1_01010 (yccB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Adeno_E3B Motif Other DBs NCBI-ProteinID:  CDH64483 LinkDB All DBs Position 1047305..1047397 Genome browser AA seq 30 aa AA seqDB search MWYLLWFVGILLMCSLSTLVLVWLDPRLKS NT seq 93 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttactttggttcgtcggcattttgttgatgtgttcgctctccacccttgtg ttggtatggctggacccgcgtctgaaaagttaa

DBGET integrated database retrieval system