Escherichia coli O18 K1 PMV-1 (ExPEC): ECOPMV1_03282 Help Entry ECOPMV1_03282     CDS       T02847                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ecoi  Escherichia coli O18:K1 PMV-1 (ExPEC) Pathway ecoi01100   Metabolic pathways ecoi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ecoi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECOPMV1_03282    00074 Mycolic acid biosynthesis     ECOPMV1_03282   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECOPMV1_03282 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 BH4 Motif Other DBs NCBI-ProteinID:  CDH66641 LinkDB All DBs Position 3379077..3379325 Genome browser AA seq 82 aa AA seqDB search MVNREIVMDYILSCLQDLVENGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIPIN ILLDVKTPAQLMETLLPWLENN NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggtaaatcgtgaaatagtaatggattacatcctttcctgtttacaggatttggtcgaa aacggtgtggaaattaagcccgacagcgatctcgtcaacgatcttggcctggagtcgatc aaagtgatggatctcttaatgatgctggaagacagattcgatatttccattcctattaat attctgctggatgtcaaaacccctgcgcaattaatggaaactctacttccatggctggag aataactaa

DBGET integrated database retrieval system