Escherichia coli JJ1886: P423_01295 Help Entry P423_01295        CDS       T02896                                  Name (GenBank) anti-sigma-28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism ecoj  Escherichia coli JJ1886 Pathway ecoj02020   Two-component system ecoj02026   Biofilm formation - Escherichia coli ecoj02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:ecoj00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     P423_01295  09140 Cellular Processes   09145 Cellular community - prokaryotes    02026 Biofilm formation - Escherichia coli     P423_01295   09142 Cell motility    02040 Flagellar assembly     P423_01295  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:ecoj02035]     P423_01295 Bacterial motility proteins [BR:ecoj02035]  Flagellar system   Flagellar assembly proteins    Others     P423_01295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM SP_0191-like Motif Other DBs NCBI-ProteinID:  AGY87070 LinkDB All DBs Position complement(283231..283509) Genome browser AA seq 92 aa AA seqDB search MKITPTMPGNHPTATMAGSSQPRKSTATTATTLSADDITQAGLQSAQQTLNDQQESDIDS DKVAQMQAMLASGSLQVDTEQLASDMLSFFQN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaaaatcaccccgactatgccaggcaatcacccgacagccacaatggcaggctccagt cagccgcgcaaaagcacggcgaccaccgccacgacgctgagcgccgatgacattacccag gcgggattgcagtctgcccagcaaacgctgaacgaccagcaagagagcgatatcgacagc gacaaagtggcacaaatgcaggcgatgctagcctccggcagcctgcaagtggacaccgag cagttagccagcgacatgctgagttttttccagaactaa

DBGET integrated database retrieval system