Escherichia coli LY180: LY180_05675 Help Entry LY180_05675       CDS       T02846                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ecol  Escherichia coli LY180 Pathway ecol01100   Metabolic pathways ecol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ecol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LY180_05675 (acpP)    00074 Mycolic acid biosynthesis     LY180_05675 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LY180_05675 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-GeneID:  16978808 NCBI-ProteinID:  AGW08456 LinkDB All DBs Position 1207342..1207578 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system