Escherichia coli LY180: LY180_15415 Help Entry LY180_15415       CDS       T02846                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism ecol  Escherichia coli LY180 Pathway ecol01100   Metabolic pathways ecol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ecol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LY180_15415    00074 Mycolic acid biosynthesis     LY180_15415   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LY180_15415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-GeneID:  16980753 NCBI-ProteinID:  AGW11758 LinkDB All DBs Position 3248504..3248731 Genome browser AA seq 75 aa AA seqDB search MDYILSCLQDLVENGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIPINILLDVKT PAQLMETLLPWLENK NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggattacatcctttcctgtttacaggatttggtcgaaaacggtgtggaaattaagccc gacagcgatctcgtcaacgatcttggcctggagtcgatcaaagtgatggatctcttaatg atgctggaagacagattcgatatttccattcctattaatattctgctggatgtcaaaacc cctgcgcaattaatggaaactctacttccatggctggagaataaataa

DBGET integrated database retrieval system