Escherichia coli LY180: LY180_19515
Help
Entry
LY180_19515 CDS
T02846
Name
(GenBank) acetolactate synthase
KO
K01652
acetolactate synthase I/II/III large subunit [EC:
2.2.1.6
]
Organism
ecol
Escherichia coli LY180
Pathway
ecol00290
Valine, leucine and isoleucine biosynthesis
ecol00650
Butanoate metabolism
ecol00660
C5-Branched dibasic acid metabolism
ecol00770
Pantothenate and CoA biosynthesis
ecol01100
Metabolic pathways
ecol01110
Biosynthesis of secondary metabolites
ecol01210
2-Oxocarboxylic acid metabolism
ecol01230
Biosynthesis of amino acids
Module
ecol_M00019
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ecol_M00570
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:
ecol00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00650 Butanoate metabolism
LY180_19515
00660 C5-Branched dibasic acid metabolism
LY180_19515
09105 Amino acid metabolism
00290 Valine, leucine and isoleucine biosynthesis
LY180_19515
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
LY180_19515
Enzymes [BR:
ecol01000
]
2. Transferases
2.2 Transferring aldehyde or ketonic groups
2.2.1 Transketolases and transaldolases
2.2.1.6 acetolactate synthase
LY180_19515
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TPP_enzyme_C
TPP_enzyme_M
TPP_enzyme_N
POR_N
XFP_N
Motif
Other DBs
NCBI-GeneID:
16981570
NCBI-ProteinID:
AGW10816
LinkDB
All DBs
Position
4091753..4093399
Genome browser
AA seq
548 aa
AA seq
DB search
MNGAQWVVHALRAQGVNTVFGYPGGAIMPVYDALYDGGVEHLLCRHEQGAAMAAIGYARA
TGKTGVCIATSGPGATNLITGLADALLDSIPVVAITGQVSAPFIGTDAFQEVDVLGLSLA
CTKHSFLVQSLEELPRIMAEAFDVASSGRPGPVLVDIPKDIQLASGDLEPWFTTVENEVT
FPHAEVEQARQMLAKAQKPMLYVGGGVGMAQAVPALREFLATTKMPATCTLKGLGAVEAD
YPYYLGMLGMHGTKAANFAVQECDLLIAVGARFDDRVTGKLNTFAPHASVIHMDIDPAEM
NKLRQAHVALQGDLNALLPALQQPLNINDWQLHCAQLRDEHAWRYDHPGDAIYAPLLLKQ
LSDRKPADCVVTTDVGQHQMWAAQHIAHTRPENFITSSGLGTMGFGLPAAVGAQVARPND
TVVCISGDGSFMMNVQELGTVKRKQLPLKIVLLDNQRLGMVRQWQQLFFQERYSETTLTD
NPDFLMLASAFGIPGQHITRKDQVEAALDTMLNSDGPYLLHVSIDELENVWPLVPPGASN
SEMLEKLS
NT seq
1647 nt
NT seq
+upstream
nt +downstream
nt
atgaatggcgcacagtgggtggtacatgcgttgcgggcacagggtgtgaacaccgttttc
ggttatccgggtggcgcaattatgccggtttacgatgcattgtatgacggcggcgtggag
cacttgctgtgccgacatgagcagggtgcggcaatggcggctatcggttatgcccgtgct
accggcaaaactggcgtatgtatcgccacgtctggtccgggcgcaaccaacctgataacc
gggcttgcggacgcactgttagattctatccctgttgttgccatcaccggtcaagtgtcc
gcaccgtttatcggcacggacgcatttcaggaagtggatgtcctgggattgtcgttagcc
tgtaccaagcacagctttctggtgcagtcgctggaagagttgccgcgcattatggctgaa
gcattcgacgttgccagctcaggtcgtcctggtccggttctggtcgatatcccaaaagat
atccagctagccagcggtgacctggaaccgtggttcaccaccgttgaaaacgaagtgact
ttcccacatgccgaagttgagcaagcgcgccagatgctggcaaaagcgcaaaaaccgatg
ctgtacgttggtggtggcgtgggtatggcgcaggcagttcctgctttacgagaatttctc
gctaccacaaaaatgcctgccacctgcacgctgaaagggctgggcgcagttgaagcagat
tatccgtactatctgggcatgctgggaatgcatggcaccaaagcggcgaacttcgcggtg
caggagtgcgacttgctgatcgccgtgggtgcacgttttgatgaccgggtgaccggcaaa
ctgaacaccttcgcaccacacgccagtgttatccatatggatatcgacccggcagaaatg
aacaagctgcgtcaggcacatgtggcattacaaggtgatttaaatgctctgttaccagca
ttacagcagccgttaaatatcaatgactggcagctacactgcgcgcagctgcgtgatgaa
catgcctggcgttacgaccatcccggtgacgctatctacgcgccattgttgttaaaacaa
ctgtcggatcgtaaacctgcggattgcgtcgtgaccacagatgtggggcagcaccagatg
tgggccgcgcagcacatcgcacacactcgcccggaaaatttcattacctccagcggctta
ggcaccatgggtttcggtttaccagcggcggttggcgcacaagtcgcacgaccgaacgat
actgtcgtctgtatctccggtgacggctctttcatgatgaatgtgcaagagctgggcacc
gtaaaacgcaagcagttaccgttgaaaatcgtcttactcgataaccaacggttagggatg
gttcgacaatggcagcaactgttttttcaggaacgatacagcgaaaccacccttactgat
aaccccgatttcctcatgttagccagcgccttcggcatccctggccaacacatcacccgt
aaagaccaggttgaagcggcactcgacaccatgctgaacagtgatgggccatacctgctt
catgtctcaatcgacgaacttgagaacgtctggccgctggtgccgcctggcgccagtaat
tcagaaatgttggagaaattatcatga
DBGET
integrated database retrieval system