Candidatus Electrothrix communis: QTN59_14190 Help Entry QTN59_14190       CDS       T09821                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ecom  Candidatus Electrothrix communis Pathway ecom01100   Metabolic pathways ecom01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ecom00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QTN59_14190 (acpP)    00074 Mycolic acid biosynthesis     QTN59_14190 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QTN59_14190 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  WLE95824 LinkDB All DBs Position complement(3212259..3212492) Genome browser AA seq 77 aa AA seqDB search MAVAEKMIDIIEEQLSVDKEKIVPGASFVDDLGADSLDLVELIMAMEEEFDVEIPDEDAE KISTVQAAIDYVGKMQA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagttgcagaaaaaatgatcgacattattgaagaacagctcagtgttgacaaagaa aaaatagttcctggcgcatcttttgttgatgacctcggtgcggattcccttgatctggtc gaactgatcatggctatggaagaagagtttgatgttgagatccctgatgaagatgcagag aaaatttcaactgtccaggctgcaattgattacgttggtaaaatgcaggcataa

DBGET integrated database retrieval system