KEGG   Escherichia coli O145 H28 RM13514 (EHEC): ECRM13514_1671
Entry
ECRM13514_1671    CDS       T03010                                 
Symbol
espM
Name
(GenBank) T3SS effector EspM
  KO
K23653  T3SS effector EspM
Organism
ecoo  Escherichia coli O145:H28 RM13514 (EHEC)
Pathway
ecoo05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecoo00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13514_1671 (espM)
SSDB
Motif
Pfam: IpaB_EvcA Potyvirid-P3 JHBP
Other DBs
NCBI-ProteinID: AHG08350
LinkDB
Position
1629891..1630367
AA seq 158 aa
MGERSIRFNVNKFSGCILETVSRQSTKDIHGWVSDERTVYPSRVINQEIDNCCLQKNAKI
SSEERKMVFSLVSKEFELTLDVKAAQSSINHIIIGNASFGKKMDALCDGMSRAVKNSTTD
YIANVLADKFYQKHIAPGVDIVKLRNEIPGYMSRVIQG
NT seq 477 nt   +upstreamnt  +downstreamnt
atgggagagcgctctatccgctttaatgttaacaaatttagcggctgtatactggagacg
gtaagcaggcagagtactaaagatattcatggatgggtaagtgatgaacggacagtatat
ccgtcaagggttatcaaccaagagattgataattgctgccttcaaaaaaatgcaaaaatt
tcttctgaagagaggaaaatggtcttttctcttgtaagtaaggagtttgaactaactctt
gatgttaaagcggcacaaagttctattaatcatataataataggaaatgcttcttttggc
aaaaaaatggatgctctttgcgatggtatgagccgagctgtaaaaaacagtacaacagat
tacatagcaaacgtgcttgcagacaagttttatcagaaacatatcgccccgggtgttgat
attgtaaaactacgaaatgaaatcccaggttatatgagtcgtgttatacaggggtaa

DBGET integrated database retrieval system