KEGG   Escherichia coli O145 H28 RM13514 (EHEC): ECRM13514_2756
Entry
ECRM13514_2756    CDS       T03010                                 
Symbol
wbuX
Name
(GenBank) N-acetyl sugar amidotransferase
  KO
K24259  putative aminotransferase
Organism
ecoo  Escherichia coli O145:H28 RM13514 (EHEC)
Pathway
ecoo00541  O-Antigen nucleotide sugar biosynthesis
ecoo01100  Metabolic pathways
ecoo01250  Biosynthesis of nucleotide sugars
Module
ecoo_M00923  UDP-L-FucNAm biosynthesis
Brite
KEGG Orthology (KO) [BR:ecoo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    ECRM13514_2756 (wbuX)
SSDB
Motif
Pfam: NAD_synthase Asn_synthase QueC ATP_bind_3 tRNA_Me_trans
Other DBs
NCBI-ProteinID: AHG09428
LinkDB
Position
complement(2635477..2636619)
AA seq 380 aa
MENKNYQICNHCIMDTSDPHITFDDSGVCNYCANYKNNILPTWRKGLFSDVSLSEMASKI
KADAKNSDFDCIIGLSGGLDSSYAAYIAKEKMGLRPLLFHVDAGWNTDQAVGNIEKLIEG
LGLELYTEVVNWEEMKDLQLSFLKSGIPDQDLVQDASFFSSLYKFARQHRIKHVITGSNF
STECCREPEEWGGYLGIDTLLFNDIHTKFGEKPLKTFPLVDILVYKIYYQKILGMKVHHP
LNLVPFNKKDAENELNKKFGWQPFQHKHHESRFTRFYEDYWLPRRFGYEKRRAHFSSLIM
TGQMSREQALERISKPEMDEHFLKQEFEYVAHKLGISVENLQELFFMPKKTYKDYKNKRW
LIGLGANVLRALGLEKRYFR
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggaaaataaaaattatcaaatttgtaatcattgtattatggatacatctgatcctcat
attacttttgatgatagcggagtatgcaattactgcgccaattataaaaacaatatattg
ccgacatggagaaaaggtttgttttcagatgtttctttatctgaaatggcaagtaaaata
aaggcggacgcaaagaatagtgattttgattgtattattggactatcaggggggcttgat
agttcatatgctgcatatattgcaaaagaaaagatggggctacgcccattattattccat
gttgatgccggctggaatacagatcaggctgttggtaatattgaaaaacttattgaaggc
cttggtttagaactttatacagaggtagtaaactgggaggaaatgaaagatcttcaactg
tctttcttaaaatcaggaattccagatcaagatctagttcaggacgcttcctttttttca
tcattatataagtttgctcgacaacatagaattaaacatgtcattacggggtccaatttt
tctactgagtgttgtcgtgaaccagaagaatggggaggatatttaggcattgatactctg
ttatttaatgatatccatacgaaatttggagaaaaaccgttaaaaacttttcctttagtg
gatatattggtttataaaatttactatcagaaaattcttggtatgaaagtgcatcatcca
ctaaatttagttccttttaataagaaggatgcagaaaatgaacttaataaaaaatttggc
tggcaacccttccagcataaacatcatgagtcccgtttcacccggttttatgaagattat
tggctgccacgcagatttggttatgagaaacgaagagctcacttttcgagtttaattatg
acgggacaaatgtctcgtgaacaagctcttgagaggatttcaaaaccagaaatggatgag
cactttcttaaacaagagtttgagtatgtagcgcacaaacttggtattagtgttgaaaat
ttgcaagagctattttttatgcccaaaaaaacatataaggattataagaataagcgttgg
ttgattggtttaggtgcgaatgtcttacgtgcacttggattagaaaaaaggtatttcaga
tga

DBGET integrated database retrieval system