Escherichia coli O145 H28 RM13514 (EHEC): ECRM13514_3002
Help
Entry
ECRM13514_3002 CDS
T03010
Symbol
yfaV
Name
(GenBank) Inner membrane transport protein YfaV
KO
K26580
MFS transporter, ACS family, inner membrane transport protein
Organism
ecoo
Escherichia coli O145:H28 RM13514 (EHEC)
Brite
KEGG Orthology (KO) [BR:
ecoo00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
ecoo02000
]
ECRM13514_3002 (yfaV)
Transporters [BR:
ecoo02000
]
Major facilitator superfamily (MFS)
Organic acid transporters
Anion:cation symporter (ACS) family [TC:
2.A.1.14
]
ECRM13514_3002 (yfaV)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MFS_1
Imm21
Motif
Other DBs
NCBI-ProteinID:
AHG09679
LinkDB
All DBs
Position
complement(2917865..2919154)
Genome browser
AA seq
429 aa
AA seq
DB search
MSTALLDAVVKKNRVRLIPFMLALYVLAFLDRSNIGFAKQTYQIDTGLSNEAYALGAGIF
FVVYAFLGVPANLLMRKLGARTWIGTTTLLWGFLSAAMAWADIEAKFLIVRTLLGAAEAG
FFPGMIYLTSQWFPQRNRASIMGLFYMGAPLALTLGSPLSGALLEMHGFMGHPGWFWIFV
IEGLLAVGAGVFTFFWLDDTPEQARFLSKQEKTLLINQLASEEQQKVTSRLSDALRNGRV
WQLAIIYLTIQVAVYGLIFFLPTQVAALLGTKVGFTASVVTAIPWVAALFGTWLIPRYSD
KTGERRNVAALTLLAAGIGIGLSGLLSPVLAIVALCVAAIGFIAVQPVFWTMPTQLLSGT
ALAAGIGFVNLFGAVGGFIAPILRVKAETLFASDAAGLLTLAAVAVIGSLIIFTLRVNRT
VAQTDVAHH
NT seq
1290 nt
NT seq
+upstream
nt +downstream
nt
atgagcaccgctttgcttgacgccgtggtgaagaaaaaccgtgtgcgtttaattccgttt
atgttggcgctgtatgtgctggcgtttctcgaccgttcgaatatcggttttgccaaacag
acctaccagattgataccgggttgagtaatgaagcttatgcgctgggagcaggcattttc
tttgtggtatatgcgtttctgggtgttccggcgaatcttttgatgcgcaaactgggggcc
agaacctggattggtacgacaacactgctgtggggatttctttcggcagccatggcatgg
gccgatattgaagcgaaatttctgatagttcgcactctgcttggtgctgcggaggccgga
tttttccctggtatgatttatctcacctcgcaatggtttccgcagcgtaatcgcgccagc
attatggggctgttctatatgggcgcaccgctggcgttaacactgggatcaccgctttcc
ggcgcgctgctggagatgcatggatttatggggcatcccggctggttctggatatttgtg
attgaaggattgttggcagtcggcgctggggtattcacattcttttggcttgatgacaca
ccggagcaggcacgttttctgagtaaacaagaaaaaacgttgcttatcaatcaactggca
agtgaagaacaacaaaaagtgacttctcggctgagcgatgcgctgcgtaatgggcgagtc
tggcaactggcgattatctacctgaccattcaggtggcggtttacggattaattttcttc
ctgccgacccaggttgcggcattgctgggaacaaaagtgggctttacagcgtcggtggtc
accgccattccgtgggttgcggccttgtttgggacctggcttattccgcgctattccgat
aaaaccggcgaacggcgtaatgtcgcagcgctgacattactggcggcgggcattggtatt
ggtctgtccgggctgctttctccagtactggcgatcgtagcgctgtgtgttgcagccatc
gggtttattgccgtgcagccggtgttctggacgatgccgacacaactgctttccggtacg
gcgctggctgcggggattggttttgtaaacctgtttggtgcagtgggcgggtttattgcc
ccgatcctgcgcgtgaaagcagaaacgttatttgccagcgatgcggcgggattactgacg
ctggcagcggtggcggtcatcggttcgctgattattttcactctgcgtgtaaatcgcacc
gttgcgcagaccgacgtggcacatcattaa
DBGET
integrated database retrieval system