Eikenella corrodens: SAMEA4412678_0757
Help
Entry
SAMEA4412678_0757 CDS
T05039
Symbol
coaD
Name
(GenBank) Phosphopantetheine adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
ecor
Eikenella corrodens
Pathway
ecor00770
Pantothenate and CoA biosynthesis
ecor01100
Metabolic pathways
ecor01240
Biosynthesis of cofactors
Module
ecor_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
ecor00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
SAMEA4412678_0757 (coaD)
Enzymes [BR:
ecor01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
SAMEA4412678_0757 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID:
SNW07762
UniProt:
A0A1A9RE86
LinkDB
All DBs
Position
1:755913..756428
Genome browser
AA seq
171 aa
AA seq
DB search
MKPHHRRAVYAGSFDPPTNGHLWMIRHAQAMFDELIVAIGTNPDKQATYTLEERKAMLVD
ITAEFPNVRVTQFHNRFLVDFADSIQADFVVRGIRSGSDYEYERAMRYINADLQPAITTV
ILMPPREFAEVSSTMVKGMVGPQNWQKTIRRYVPDAVYRKILADHGCLAED
NT seq
516 nt
NT seq
+upstream
nt +downstream
nt
atgaaaccacaccaccgccgcgccgtttacgccggcagtttcgacccccccaccaacggc
cacctatggatgatccgccacgcacaggccatgtttgacgaacttatcgtggccatcggc
accaatcccgacaagcaggccacctacacactggaagagcgcaaagctatgttggtggac
atcaccgccgaattccccaatgtgcgcgttactcagttccacaaccgttttctggttgat
tttgccgatagcatccaagccgatttcgtggtgcgtggcatccgcagcggctcagactat
gaatacgaacgtgccatgcgctacatcaatgccgacctgcaaccagccatcaccaccgtt
atcctgatgccgccgcgcgaatttgccgaagtatcttccaccatggtcaaaggcatggtc
ggcccgcaaaactggcagaaaaccatccgccgctatgtccccgatgctgtgtaccgtaaa
atactggctgaccacggctgtttggctgaagattga
DBGET
integrated database retrieval system