Escherichia coli O6 K15 H31 536 (UPEC): ECP_1086 Help Entry ECP_1086          CDS       T00373                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ecp  Escherichia coli O6:K15:H31 536 (UPEC) Pathway ecp01100   Metabolic pathways ecp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ecp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECP_1086    00074 Mycolic acid biosynthesis     ECP_1086   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECP_1086 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  ABG69099 UniProt:  Q0TIY0 LinkDB All DBs Position 1142494..1142730 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system