Escherichia coli O6 K15 H31 536 (UPEC): ECP_1095 Help Entry ECP_1095          CDS       T00373                                  Name (GenBank) HIT-like protein YcfF   KO K02503   histidine triad (HIT) family protein [EC:3.9.1.-] Organism ecp  Escherichia coli O6:K15:H31 536 (UPEC) Brite KEGG Orthology (KO) [BR:ecp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:ecp03016]     ECP_1095   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ecp04147]     ECP_1095 Transfer RNA biogenesis [BR:ecp03016]  Eukaryotic type   Aminoacyl-tRNA synthetases (AARSs)    AARS associated factors     ECP_1095 Exosome [BR:ecp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    ECP_1095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HIT DcpS_C Motif Other DBs NCBI-ProteinID:  ABG69108 UniProt:  A0A454A339 LinkDB All DBs Position 1152764..1153123 Genome browser AA seq 119 aa AA seqDB search MAEETIFSKIIRREIPSDIVYQDDLVTAFRDISPQAPTHILIIPNILIPTVNDVSAEHEQ ALGRMITVAAKIAEQEGIAEDGYRLIMNTNRHGGQEVYHIHMHLLGGRPLGPMLTHKGL NT seq 360 nt NT seq  +upstreamnt  +downstreamnt gtggcagaagaaactatattcagcaaaattattcgtcgtgagatcccctccgatatcgtc taccaggatgatctggtaacggcgtttcgcgatatttcgccgcaagcgccaacgcatatt ctgatcattccgaatatcctcattccgactgtgaacgacgtgtcagctgagcatgagcag gcgctgggacgcatgatcaccgtagcggcaaaaattgctgagcaagaaggtattgccgaa gatggctatcgtctgatcatgaacaccaaccgccatggcggacaagaagtttaccacatc catatgcatttgttgggtggccgtccgctgggaccaatgctgacgcataaaggtctgtaa

DBGET integrated database retrieval system