Escherichia coli O81 ED1a (commensal): ECED1_1237 Help Entry ECED1_1237        CDS       T00827                                  Symbol acpP Name (GenBank) acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism ecq  Escherichia coli O81 ED1a (commensal) Pathway ecq01100   Metabolic pathways ecq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ecq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECED1_1237 (acpP)    00074 Mycolic acid biosynthesis     ECED1_1237 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECED1_1237 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  CAR07438 UniProt:  B7MTM4 LinkDB All DBs Position 1237597..1237833 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system