Escherichia coli O8 IAI1 (commensal): ECIAI1_3783 Help Entry ECIAI1_3783       CDS       T00828                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism ecr  Escherichia coli O8 IAI1 (commensal) Brite KEGG Orthology (KO) [BR:ecr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ecr03110]     ECIAI1_3783 (grxC) Chaperones and folding catalysts [BR:ecr03110]  Protein folding catalysts   Protein disulfide isomerase    ECIAI1_3783 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR GST_N Thioredoxin_2 Thioredoxin_3 CLIC-like_N Motif Other DBs NCBI-ProteinID:  CAR00580 LinkDB All DBs Position complement(3858079..3858330) Genome browser AA seq 83 aa AA seqDB search MANVEIYTKETCPYCHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGRTTVPQIFIDA QHIGGCDDLYALDARGGLDPLLK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggccaatgttgaaatctataccaaagaaacctgcccgtattgccatcgtgcaaaagca ctgctgagcagcaagggcgtgagtttccaggagctgccgatcgatggcaatgccgccaag cgtgaagagatgatcaaacgcagcggtcgcaccacggttccccagatttttattgacgca cagcacattggcggctgtgatgacttgtatgcattggatgcacgtggtggactggatccc ctgctgaaataa

DBGET integrated database retrieval system