Etheostoma cragini (Arkansas darter): 117937342 Help Entry 117937342         CDS       T07493                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism ecra  Etheostoma cragini (Arkansas darter) Pathway ecra04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ecra00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     117937342  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ecra04121]     117937342    03400 DNA repair and recombination proteins [BR:ecra03400]     117937342 Ubiquitin system [BR:ecra04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      117937342    Cul5 complex      117937342 DNA repair and recombination proteins [BR:ecra03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      117937342 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD LED_rpt Motif Other DBs NCBI-GeneID:  117937342 NCBI-ProteinID:  XP_034717131 LinkDB All DBs Position 21:10435921..10439127 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEDQRLYKDDQSLEDSKTLGDC GFTNQTARPQAPATIGLAFRINDDMFEQLHVEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcttaatgatacggcgtcacaagaccacaatcttcacagatgccaaggag tctaccactgtgtatgagctgaagcgtattgttgaagggatccttaagagagcacctgaa gaccagaggctgtacaaagatgaccagtcgctagaggacagcaaaactcttggtgactgt ggatttaccaaccagactgccagacctcaagccccagctacaattggtctggccttccgc attaatgatgacatgttcgaacagctgcacgtcgaggccttctccagccccccagaactc cctgatgtgatgaagcctcaggactccggtagcactgccaatgaacaggcagtgcagtga

DBGET integrated database retrieval system