Etheostoma cragini (Arkansas darter): 117938094 Help Entry 117938094         CDS       T07493                                  Name (RefSeq) cystatin-B-like isoform X1   KO K13907   cystatin-A/B Organism ecra  Etheostoma cragini (Arkansas darter) Brite KEGG Orthology (KO) [BR:ecra00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:ecra01002]     117938094   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ecra04147]     117938094 Peptidases and inhibitors [BR:ecra01002]  Peptidase inhibitors   Family I25: cystatin family    117938094 Exosome [BR:ecra04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    117938094 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light Motif Other DBs NCBI-GeneID:  117938094 NCBI-ProteinID:  XP_034718349 LinkDB All DBs Position 22:13765048..13768097 Genome browser AA seq 100 aa AA seqDB search MPTMCGGTSPPVDADEKIQKLCDHVKSSAEAKAGKTYDVFTAKSYTKQVVAGTNYFIKVH VGGEQHVHLRVYEKLPCYGGDIELSDMQHSKTHQDPIEYF NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccgacgatgtgtggaggaacttccccgccagtggatgctgacgaaaaaattcagaag ctttgtgatcacgtgaagtccagtgcagaggcaaaagcagggaagacgtatgatgttttc acagcaaagagctacacaaagcaggtagtggccgggaccaactacttcatcaaggtccat gtgggaggagagcaacatgttcacctccgcgtttacgaaaaactcccatgttacggagga gacatagagctgagtgatatgcagcactcaaagacccaccaagaccctattgagtacttc taa

DBGET integrated database retrieval system