Etheostoma cragini (Arkansas darter): 117940498 Help Entry 117940498         CDS       T07493                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism ecra  Etheostoma cragini (Arkansas darter) Pathway ecra03030   DNA replication ecra03082   ATP-dependent chromatin remodeling ecra03410   Base excision repair ecra03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ecra00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     117940498 (pole3)    03410 Base excision repair     117940498 (pole3)    03420 Nucleotide excision repair     117940498 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     117940498 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ecra03032]     117940498 (pole3)    03036 Chromosome and associated proteins [BR:ecra03036]     117940498 (pole3)    03400 DNA repair and recombination proteins [BR:ecra03400]     117940498 (pole3) Enzymes [BR:ecra01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      117940498 (pole3) DNA replication proteins [BR:ecra03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     117940498 (pole3) Chromosome and associated proteins [BR:ecra03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     117940498 (pole3) DNA repair and recombination proteins [BR:ecra03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       117940498 (pole3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BUD22 Histone DUF3276 DUF789 Thg1C Trypan_PARP Astro_capsid_p DUF4746 Motif Other DBs NCBI-GeneID:  117940498 NCBI-ProteinID:  XP_034721651 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search ANNFALKAKRKTLNAGDVLAAMEEMEFERFLEPLREALEVYKKGQKGKKEVSEQKRKDKE KKPDSENDKSREEEEEEEEEEERMEEDRVEEEPEAENEGEDEEVEN NT seq 322 nt NT seq  +upstreamnt  +downstreamnt cgccaacaacttcgccctgaaagccaaacggaagactctgaacgcgggagacgttctggc cgcgatggaggaaatggagtttgagagattcctggagccgctcagagaagctctggaagt gtacaagaagggccagaaagggaagaaggaggtttcggagcagaagcgtaaagacaagga gaagaagccggactctgagaacgataagagccgggaggaggaggaggaagaggaggagga ggaagagcgcatggaggaggaccgcgtggaggaggagcccgaagccgagaacgaaggcga ggacgaggaggtggagaactga

DBGET integrated database retrieval system