Etheostoma cragini (Arkansas darter): 117949110 Help Entry 117949110         CDS       T07493                                  Symbol hrasb Name (RefSeq) HRas proto-oncogene, GTPase b   KO K02833   GTPase HRas Organism ecra  Etheostoma cragini (Arkansas darter) Pathway ecra04010   MAPK signaling pathway ecra04012   ErbB signaling pathway ecra04068   FoxO signaling pathway ecra04137   Mitophagy - animal ecra04140   Autophagy - animal ecra04144   Endocytosis ecra04150   mTOR signaling pathway ecra04210   Apoptosis ecra04218   Cellular senescence ecra04370   VEGF signaling pathway ecra04371   Apelin signaling pathway ecra04510   Focal adhesion ecra04540   Gap junction ecra04625   C-type lectin receptor signaling pathway ecra04810   Regulation of actin cytoskeleton ecra04910   Insulin signaling pathway ecra04912   GnRH signaling pathway ecra04916   Melanogenesis ecra05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ecra00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     117949110 (hrasb)    04012 ErbB signaling pathway     117949110 (hrasb)    04370 VEGF signaling pathway     117949110 (hrasb)    04371 Apelin signaling pathway     117949110 (hrasb)    04068 FoxO signaling pathway     117949110 (hrasb)    04150 mTOR signaling pathway     117949110 (hrasb)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     117949110 (hrasb)    04140 Autophagy - animal     117949110 (hrasb)    04137 Mitophagy - animal     117949110 (hrasb)   09143 Cell growth and death    04210 Apoptosis     117949110 (hrasb)    04218 Cellular senescence     117949110 (hrasb)   09144 Cellular community - eukaryotes    04510 Focal adhesion     117949110 (hrasb)    04540 Gap junction     117949110 (hrasb)   09142 Cell motility    04810 Regulation of actin cytoskeleton     117949110 (hrasb)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     117949110 (hrasb)   09152 Endocrine system    04910 Insulin signaling pathway     117949110 (hrasb)    04912 GnRH signaling pathway     117949110 (hrasb)    04916 Melanogenesis     117949110 (hrasb)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117949110 (hrasb)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ecra04131]     117949110 (hrasb)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ecra04147]     117949110 (hrasb)    04031 GTP-binding proteins [BR:ecra04031]     117949110 (hrasb) Membrane trafficking [BR:ecra04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     117949110 (hrasb)  Endocytosis   Macropinocytosis    Ras GTPases     117949110 (hrasb) Exosome [BR:ecra04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    117949110 (hrasb)   Exosomal proteins of colorectal cancer cells    117949110 (hrasb) GTP-binding proteins [BR:ecra04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     117949110 (hrasb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  117949110 NCBI-ProteinID:  XP_034735015 LinkDB All DBs Position 8:complement(19074492..19093118) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMTCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctggtggtggtgggagctggaggtgtgggcaagagtgcgcttacc atccagctcatccaaaaccactttgtggatgaatacgaccccaccatagaggactcgtac aggaaacaggttgtgattgatggggaaacctgcctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggatcagtacatgaggacaggggagggtttcctctgt gtcttcgccatcaacaacaccaagtcttttgaggacattcaccagtacagagaacagatt aaacgtgtgaaggactcagacgatgttcccatggtgcttgtgggaaacaaatgtgacctc ccggcacgcacggtggacacaaggcaagcccaagaactcgcccgctcttacggcatccct tacatcgagacctctgccaaaacacgtcagggagtagaggatgccttctacacactggtt cgggagatcagacagcataagctgaggaagctgaacccacctgatgagagcggtcaggac tgtatgacctgtcgctgtgtggtatcgtga

DBGET integrated database retrieval system